PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27379.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 364aa    MW: 41073.9 Da    PI: 6.4204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27379.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd  l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  mrna27379.1-v1.0-hybrid 14 KGPWSPEEDATLKAYIEEHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding38.62.6e-1269111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd ++ ++    G++ W+ Ia+ ++ gRt++++k++w++
  mrna27379.1-v1.0-hybrid  69 GGFSEEEDNIICNLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.255962IPR017930Myb domain
SuperFamilySSF466891.55E-2611109IPR009057Homeodomain-like
SMARTSM007171.2E-121364IPR001005SANT/Myb domain
PfamPF002492.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241569IPR009057Homeodomain-like
CDDcd001673.75E-91662No hitNo description
PROSITE profilePS5129421.7763117IPR017930Myb domain
SMARTSM007172.7E-1167115IPR001005SANT/Myb domain
PfamPF002498.8E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2370117IPR009057Homeodomain-like
CDDcd001674.67E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDATLKAYIE EHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC NLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKQSGANRGS QDLKDAADDA HQALSSSALE RLQLHMQLQN LQNPFSFYNN PALWPKLHPF  180
QEKMIQTAQC MNDQNSSNPL MMQQFSVSTH DQTVQGHKVN DHFYEQTAGA LAIQEQYAKL  240
CINPKMDELE NALNGMSSSF ISATSNPVDS TIVIPKADHI ERQVNSSFQA QLDGNNSGSF  300
TSQQQDDQIA EFDYFKEMNV SKESLMWWAN DFDNKSVSSN SWDSTSVLQS QGMFQDYELG  360
YNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM6917803e-65AM691780.1 Fragaria x ananassa microsatellite DNA, locus CFaCT80.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296741.10.0PREDICTED: transcription factor RAX3
SwissprotQ9FKL21e-103MYB36_ARATH; Transcription factor MYB36
TrEMBLM5XIY10.0M5XIY1_PRUPE; Uncharacterized protein
STRINGPOPTR_0018s10390.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-86myb domain protein 36